Research Article
Immunoinformatics Approach to Design a Chimeric CD70-Peptide Vaccine against Renal Cell Carcinoma
Table 7
Predicted linear epitopes of CD70 (Homo sapiens) peptide vaccine constructs.
| Construct | No. | Chain | Start | End | Peptide | Number of residues | Score |
| CD70-CPP-TNF (Homo sapiens) | 1 | A | 180 | 247 | ESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLIS | 68 | 0.818 | 2 | A | 335 | 341 | ITVSYQT | 7 | 0.797 | 3 | A | 354 | 365 | QRETPEGAEAKP | 12 | 0.759 | 4 | A | 114 | 166 | AAYGWDVAELQLNHTGPQQDPRAAYQDPRLYWQGGPALGRSAAYRQIKIWFQN | 53 | 0.711 | 5 | A | 86 | 93 | YSPASRSI | 8 | 0.707 | 6 | A | 66 | 76 | AAYTTASRHHP | 11 | 0.652 | 7 | A | 377 | 383 | QLEKGDR | 7 | 0.643 | 8 | A | 301 | 305 | VVPSE | 5 | 0.638 | 9 | A | 254 | 263 | RSSSRTPSDK | 10 | 0.592 | 10 | A | 52 | 55 | HRDG | 4 | 0.578 | 11 | A | 290 | 298 | ANGVELRDN | 9 | 0.533 | 12 | A | 319 | 326 | QGCPSTHV | 8 | 0.52 | 13 | A | 1 | 11 | QAQQQLPLESL | 11 | 0.517 |
|
|